Back to All Skills
Best Claude Code Skills for Automation
73 skills tagged with “automation”
Playwright Browser Automation
Browser automation and testing using Playwright for web application testing and scraping
playwrightbrowsertestingautomation+1
iOS Simulator
Build, navigate, and test iOS apps via simulator automation with XcodeBuild integration
iosxcodemobiletesting+1
Project Environment Setup
Detect project stack and automatically configure the local development environment with dependencies, tools, and services
setupenvironmentdevtoolsonboarding+1
Skyvern Browser Automation
AI-powered browser automation — navigate sites, fill forms, extract structured data, log in with stored credentials, and build reusable workflows
browserautomationscrapingai+1
Ansible Ops
Write, review, lint, convert, and debug Ansible with production best practices — FQCN, idempotency, validated templates, no_log secrets, and ansible-lint/yamllint
ansibledevopslintinginfrastructure+1
Google Workspace Cli
Google Workspace administration via the gws CLI (github.com/googleworkspace/cli). Install, authenticate, and automate Gmail, Drive, Sheets, Calendar, Docs, Chat, and Tasks. Run security audits and use local recipe templates and persona bundles. Use for Google Workspace admin, gw…
gogithubsecurityautomation+1
Playwright Pro
Production-grade Playwright testing toolkit. Use when the user mentions Playwright tests, end-to-end testing, browser automation, fixing flaky tests, test migration, CI/CD testing, or test suites. Generate tests, fix flaky failures, migrate from Cypress/Selenium, sync with TestR…
testingbrowserautomationai+1
Code Reviewer
Code review automation for TypeScript, JavaScript, Python, Go, Swift, Kotlin, C#, .NET, Java, C, C++, Rust, Ruby, PHP, and Dart/Flutter. Analyzes PRs for complexity and risk, checks code quality for SOLID violations and code smells, generates review reports. Use when reviewing p…
pythontypescriptjavascriptrust+4
Ms365 Tenant Manager
Microsoft 365 tenant administration for Global Administrators. Automate M365 tenant setup, Office 365 admin tasks, Azure AD user management, Exchange Online configuration, Teams administration, and security policies. Generate PowerShell scripts for bulk operations, Conditional A…
azuresecurityautomation
Senior Devops
Comprehensive DevOps skill for CI/CD, infrastructure automation, containerization, and cloud platforms (AWS, GCP, Azure). Includes pipeline setup, infrastructure as code, deployment automation, and monitoring. Use when setting up pipelines, deploying applications, managing infra…
awsgcpazuredeployment+3
Agent Designer
Use when the user asks to design a multi-agent system, pick an orchestration pattern (supervisor/swarm/pipeline), generate tool schemas for agents, or evaluate agent execution logs for cost, latency, and failure bottlenecks. Examples: 'design an agent architecture for research a…
automationaiagent
Engineering Advanced Skills
Index of 37 advanced engineering agent skills for Claude Code, Codex, Gemini CLI, Cursor, OpenClaw. Use when browsing or choosing among the POWERFUL-tier engineering skills: agent design, RAG, MCP servers, CI/CD, database design, observability, security auditing, changelog/relea…
securityautomationragagent
Email Sequence
When the user wants to create or optimize an email sequence, drip campaign, automated email flow, or lifecycle email program. Also use when the user mentions "email sequence," "drip campaign," "nurture sequence," "onboarding emails," "welcome sequence," "re-engagement emails," "…
automationai
Jira Expert
Atlassian Jira expert for creating and managing projects, planning, product discovery, JQL queries, workflows, custom fields, automation, reporting, and all Jira features. Use when setting up or configuring Jira projects, writing JQL and advanced searches, creating dashboards, d…
jiraautomation
Gdpr Dsgvo Expert
GDPR and German DSGVO compliance automation. Scans codebases for privacy risks, generates DPIA documentation, tracks data subject rights requests with Art. 12(3) one-month deadlines. Use when running GDPR compliance assessments, privacy audits, data protection planning, DPIA gen…
automation
Notebooklm
Browser automation skill for controlling Google's NotebookLM. Use when the user wants anything done in NotebookLM (e.g., 'open NotebookLM', 'check my [name] notebook', 'ask my notebook about X', 'add [source] to NotebookLM', 'generate a Video Overview from my notebook', 'use Not…
gobrowserautomationai
Shipping Artifacts
The durable documentation set that makes an AI-built (vibe-coded) app reviewable before shipping. A small core every app needs — architecture, user/permission flows, permissions, variables/secrets, and a test-coverage map — plus conditional docs added only when they apply: email…
rustsecurityperformanceautomation+3
App Store Deployment
Publishes mobile applications to iOS App Store and Google Play with code signing, versioning, and CI/CD automation. Use when preparing app releases, configuring signing certificates, or setting up automated deployment pipelines.
godeploymentautomation
Chrome Devtools
Browser automation with Puppeteer CLI scripts. Use for screenshots, performance analysis, network monitoring, web scraping, form automation, or encountering JavaScript debugging, browser automation errors.
javascriptperformancemonitoringbrowser+3
Claude Code Bash Patterns
Claude Code Bash tool patterns with hooks, automation, git workflows. Use for PreToolUse hooks, command chaining, CLI orchestration, custom commands, or encountering bash permissions, command failures, security guards, hook configurations.
securityautomationai
Github Project Automation
GitHub repository automation (CI/CD, issue templates, Dependabot, CodeQL). Use for project setup, Actions workflows, security scanning, or encountering YAML syntax, workflow configuration, template structure errors.
githubsecurityautomation
Ml Pipeline Automation
Automate ML workflows with Airflow, Kubeflow, MLflow. Use for reproducible pipelines, retraining schedules, MLOps, or encountering task failures, dependency errors, experiment tracking issues.
automationai
Mobile App Testing
Mobile app testing with unit tests, UI automation, performance testing. Use for test infrastructure, E2E tests, testing standards, or encountering test framework setup, device farms, flaky tests, platform-specific test errors.
testingperformanceautomation
Playwright
Browser automation and E2E testing with Playwright. Auto-detects dev servers, writes clean test scripts. Test pages, fill forms, take screenshots, check responsive design, validate UX, test login flows, check links, automate any browser task. Use for cross-browser testing, visua…
pythontypescriptjavascripttesting+3
Api Test Generator
Generate api test generator operations. Auto-activating skill for Test Automation. Triggers on: api test generator, api test generator Part of the Test Automation skill category. Use when working with APIs or building integrations. Trigger with phrases like "api test generator",…
goautomationapi
Contract Test Creator
Create contract test creator operations. Auto-activating skill for Test Automation. Triggers on: contract test creator, contract test creator Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "contract test creator", "contra…
goautomation
Coverage Report Analyzer
Analyze coverage report analyzer operations. Auto-activating skill for Test Automation. Triggers on: coverage report analyzer, coverage report analyzer Part of the Test Automation skill category. Use when analyzing or auditing coverage report analyzer. Trigger with phrases like …
goautomationrag
Database Test Helper
Assist with database test helper operations. Auto-activating skill for Test Automation. Triggers on: database test helper, database test helper Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "database test helper", "datab…
goautomation
Factory Pattern Creator
Create factory pattern creator operations. Auto-activating skill for Test Automation. Triggers on: factory pattern creator, factory pattern creator Part of the Test Automation skill category. Use when working with factory pattern creator functionality. Trigger with phrases like …
goautomation
Fixture Generator
Generate fixture generator operations. Auto-activating skill for Test Automation. Triggers on: fixture generator, fixture generator Part of the Test Automation skill category. Use when working with fixture generator functionality. Trigger with phrases like "fixture generator", "…
goautomation
Flaky Test Detector
Detect flaky test detector operations. Auto-activating skill for Test Automation. Triggers on: flaky test detector, flaky test detector Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "flaky test detector", "flaky detector…
goautomation
Go Test Generator
Generate go test generator operations. Auto-activating skill for Test Automation. Triggers on: go test generator, go test generator Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "go test generator", "go generator", "go".
goautomation
Integration Test Setup
Configure integration test setup operations. Auto-activating skill for Test Automation. Triggers on: integration test setup, integration test setup Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "integration test setup", …
goautomation
Jest Test Generator
Generate jest test generator operations. Auto-activating skill for Test Automation. Triggers on: jest test generator, jest test generator Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "jest test generator", "jest generat…
goautomation
Mocha Test Setup
Configure mocha test setup operations. Auto-activating skill for Test Automation. Triggers on: mocha test setup, mocha test setup Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "mocha test setup", "mocha setup", "mocha".
goautomation
Mock Generator
Generate mock generator operations. Auto-activating skill for Test Automation. Triggers on: mock generator, mock generator Part of the Test Automation skill category. Use when working with mock generator functionality. Trigger with phrases like "mock generator", "mock generator"…
goautomation
Mutation Test Runner
Run mutation test runner operations. Auto-activating skill for Test Automation. Triggers on: mutation test runner, mutation test runner Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "mutation test runner", "mutation runn…
goautomation
Property Based Test Helper
Assist with property based test helper operations. Auto-activating skill for Test Automation. Triggers on: property based test helper, property based test helper Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "property ba…
goautomation
Pytest Test Generator
Generate pytest test generator operations. Auto-activating skill for Test Automation. Triggers on: pytest test generator, pytest test generator Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "pytest test generator", "pyte…
goautomation
Snapshot Test Helper
Assist with snapshot test helper operations. Auto-activating skill for Test Automation. Triggers on: snapshot test helper, snapshot test helper Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "snapshot test helper", "snaps…
goautomation
Spy Setup Helper
Assist with spy setup helper operations. Auto-activating skill for Test Automation. Triggers on: spy setup helper, spy setup helper Part of the Test Automation skill category. Use when working with spy setup helper functionality. Trigger with phrases like "spy setup helper", "sp…
goautomation
Stub Creator
Create stub creator operations. Auto-activating skill for Test Automation. Triggers on: stub creator, stub creator Part of the Test Automation skill category. Use when working with stub creator functionality. Trigger with phrases like "stub creator", "stub creator", "stub".
goautomation
Test Data Builder
Test Data Builder - Auto-activating skill for Test Automation. Triggers on: test data builder, test data builder Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "test data builder", "test builder", "test".
goautomation
Test Naming Enforcer
Test Naming Enforcer - Auto-activating skill for Test Automation. Triggers on: test naming enforcer, test naming enforcer Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "test naming enforcer", "test enforcer", "test".
goautomation
Test Organization Helper
Test Organization Helper - Auto-activating skill for Test Automation. Triggers on: test organization helper, test organization helper Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "test organization helper", "test helper…
goautomation
Test Parallelizer
Test Parallelizer - Auto-activating skill for Test Automation. Triggers on: test parallelizer, test parallelizer Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "test parallelizer", "test parallelizer", "test".
goautomation
Test Retry Config
Test Retry Config - Auto-activating skill for Test Automation. Triggers on: test retry config, test retry config Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "test retry config", "test config", "test".
goautomation
Unittest Test Creator
Create unittest test creator operations. Auto-activating skill for Test Automation. Triggers on: unittest test creator, unittest test creator Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "unittest test creator", "unitte…
goautomation
Vitest Test Creator
Create vitest test creator operations. Auto-activating skill for Test Automation. Triggers on: vitest test creator, vitest test creator Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "vitest test creator", "vitest creator…
goautomation
Approval Workflow Generator
Generate approval workflow generator operations. Auto-activating skill for Business Automation. Triggers on: approval workflow generator, approval workflow generator Part of the Business Automation skill category. Use when working with approval workflow generator functionality. …
goautomation
Batch File Processor
Process batch file processor operations. Auto-activating skill for Business Automation. Triggers on: batch file processor, batch file processor Part of the Business Automation skill category. Use when working with batch file processor functionality. Trigger with phrases like "ba…
goautomation
Calendar Event Creator
Create calendar event creator operations. Auto-activating skill for Business Automation. Triggers on: calendar event creator, calendar event creator Part of the Business Automation skill category. Use when working with calendar event creator functionality. Trigger with phrases l…
goautomation
Csv Processor
Process csv processor operations. Auto-activating skill for Business Automation. Triggers on: csv processor, csv processor Part of the Business Automation skill category. Use when working with csv processor functionality. Trigger with phrases like "csv processor", "csv processor…
goautomation
Discord Bot Generator
Generate discord bot generator operations. Auto-activating skill for Business Automation. Triggers on: discord bot generator, discord bot generator Part of the Business Automation skill category. Use when working with discord bot generator functionality. Trigger with phrases lik…
godiscordautomation
Document Merger
Manage document merger operations. Auto-activating skill for Business Automation. Triggers on: document merger, document merger Part of the Business Automation skill category. Use when working with document merger functionality. Trigger with phrases like "document merger", "docu…
goautomation
Email Parser
Configure and manage - Parse email parser operations. Auto-activating skill for Business Automation. Triggers on: email parser, email parser Part of the Business Automation skill category. Use when working with email parser functionality. Trigger with phrases like "email parser"…
goautomationai
Excel Formula Generator
Generate excel formula generator operations. Auto-activating skill for Business Automation. Triggers on: excel formula generator, excel formula generator Part of the Business Automation skill category. Use when working with excel formula generator functionality. Trigger with phr…
goautomation
Excel Macro Creator
Create excel macro creator operations. Auto-activating skill for Business Automation. Triggers on: excel macro creator, excel macro creator Part of the Business Automation skill category. Use when working with excel macro creator functionality. Trigger with phrases like "excel m…
goautomation
Form Builder Helper
Build form builder helper operations. Auto-activating skill for Business Automation. Triggers on: form builder helper, form builder helper Part of the Business Automation skill category. Use when working with form builder helper functionality. Trigger with phrases like "form bui…
goautomation
Google Sheets Automation
Manage google sheets automation operations. Auto-activating skill for Business Automation. Triggers on: google sheets automation, google sheets automation Part of the Business Automation skill category. Use when working with google sheets automation functionality. Trigger with p…
goautomation
Invoice Generator
Generate invoice generator operations. Auto-activating skill for Business Automation. Triggers on: invoice generator, invoice generator Part of the Business Automation skill category. Use when working with invoice generator functionality. Trigger with phrases like "invoice gener…
goautomation
Make Scenario Creator
Create make scenario creator operations. Auto-activating skill for Business Automation. Triggers on: make scenario creator, make scenario creator Part of the Business Automation skill category. Use when working with make scenario creator functionality. Trigger with phrases like …
goautomation
Meeting Scheduler Helper
Configure with meeting scheduler helper operations. Auto-activating skill for Business Automation. Triggers on: meeting scheduler helper, meeting scheduler helper Part of the Business Automation skill category. Use when working with meeting scheduler helper functionality. Trigge…
goautomation
N8n Workflow Generator
Generate n8n workflow generator operations. Auto-activating skill for Business Automation. Triggers on: n8n workflow generator, n8n workflow generator Part of the Business Automation skill category. Use when working with n8n workflow generator functionality. Trigger with phrases…
goautomation
Notification Dispatcher
Manage notification dispatcher operations. Auto-activating skill for Business Automation. Triggers on: notification dispatcher, notification dispatcher Part of the Business Automation skill category. Use when working with notification dispatcher functionality. Trigger with phras…
goautomation
Pdf Generator
Generate pdf generator operations. Auto-activating skill for Business Automation. Triggers on: pdf generator, pdf generator Part of the Business Automation skill category. Use when working with pdf generator functionality. Trigger with phrases like "pdf generator", "pdf generato…
goautomation
Pdf Parser
Configure and manage - Parse pdf parser operations. Auto-activating skill for Business Automation. Triggers on: pdf parser, pdf parser Part of the Business Automation skill category. Use when working with pdf parser functionality. Trigger with phrases like "pdf parser", "pdf par…
goautomation
Reminder System Creator
Create reminder system creator operations. Auto-activating skill for Business Automation. Triggers on: reminder system creator, reminder system creator Part of the Business Automation skill category. Use when working with reminder system creator functionality. Trigger with phras…
goautomation
Report Generator
Generate report generator operations. Auto-activating skill for Business Automation. Triggers on: report generator, report generator Part of the Business Automation skill category. Use when working with report generator functionality. Trigger with phrases like "report generator"…
goautomation
Slack Bot Creator
Create slack bot creator operations. Auto-activating skill for Business Automation. Triggers on: slack bot creator, slack bot creator Part of the Business Automation skill category. Use when working with slack bot creator functionality. Trigger with phrases like "slack bot creat…
goslackautomation
Survey Creator
Create survey creator operations. Auto-activating skill for Business Automation. Triggers on: survey creator, survey creator Part of the Business Automation skill category. Use when working with survey creator functionality. Trigger with phrases like "survey creator", "survey cr…
goautomation
Teams Webhook Sender
Manage teams webhook sender operations. Auto-activating skill for Business Automation. Triggers on: teams webhook sender, teams webhook sender Part of the Business Automation skill category. Use when working with teams webhook sender functionality. Trigger with phrases like "tea…
goautomation
Zapier Integration Helper
Assist with zapier integration helper operations. Auto-activating skill for Business Automation. Triggers on: zapier integration helper, zapier integration helper Part of the Business Automation skill category. Use when working with APIs or building integrations. Trigger with ph…
goautomationapi
Browse more topics
agentagent-skillsaiansibleanthropicapiarchitectureattestationauditautomationawsazurebenchmarkingbisectbrowserbuildcaptionschangelogchartsciclaudecleanupcloudflarecode-qualitycode-reviewcommitcompliancecomposecontainerscontentcontextcoveragecracsvd3datadatabasedebuggingdependenciesdeploymentdevelopmentdevopsdevtoolsdiagramsdiscorddjangodockerdocumentationdocumentsdocxdorae2eefficiencyembeddingengineering-code-qualityenvironmenteu-regulationevidenceexcelexplainerexplanationfaviconfilesflaskfrontendgcpgdprgitgithubgitlabgographqlhookshygieneimagesincident-responseindexesinfrastructureiosjavascriptjirakotlinkuberneteslearninglinearlintingllmmaintenancemcpmemorymermaidmetameta-tagsmigrationmigrationsmobilemonitoringmonorepomysqlnextjsnis2nodenpmofficialonboardingopenapioptimizationowasppackagesparsingpatternspdfperformanceplanningplaywrightpostgrespowerpointpptxprprivacyproductivityprofilingprotocolprototypingpwapythonqaquery-optimizationragrapid-developmentreactredisrefactoringregexregressionreleasereportsrestreviewrustsafetyschemascrapingsdksdlcsecuritysemverserversetupskillsslackslidesspreadsheetssqlsqliteswaggerswifttddteachingtest-generationtestingthreat-modelingtokenstranscripttypescriptutilityvalidationvercelversioningvibe-codingvideovisualizationvuevulnerabilitiesvulnerability-managementwebwordworkflowworkflowsworkspacexcodexlsxyoutube