Back to All Skills
Best Claude Code Skills for Cloudflare
43 skills tagged with “cloudflare”
Better Auth
Skill for integrating Better Auth - comprehensive TypeScript authentication framework for Cloudflare D1, Next.js, Nuxt, and 15+ frameworks. Use when adding auth, encountering D1 adapter errors, or implementing OAuth/2FA/RBAC features.
typescriptcloudflare
Bun Cloudflare Workers
This skill should be used when the user asks about "Cloudflare Workers with Bun", "deploying Bun to Workers", "wrangler with Bun", "edge deployment", "Bun to Cloudflare", or building and deploying applications to Cloudflare Workers using Bun.
cloudflaredeployment
Cloudflare Agents
Build AI agents on Cloudflare Workers with MCP integration, tool use, and LLM providers.
cloudflareaillmagent
Cloudflare Browser Rendering
Cloudflare Browser Rendering with Puppeteer/Playwright. Use for screenshots, PDFs, web scraping, or encountering rendering errors, timeout issues, memory exceeded.
cloudflarebrowserscrapingapi
Cloudflare Cron Triggers
Cloudflare Cron Triggers for scheduled Workers execution. Use for periodic tasks, scheduled jobs, or encountering handler not found, invalid cron expression, timezone errors.
cloudflare
Cloudflare D1
Cloudflare D1 serverless SQLite on edge. Use for databases, migrations, bindings, or encountering D1_ERROR, statement too long, too many requests queued errors.
sqlitecloudflare
Cloudflare Durable Objects
Cloudflare Durable Objects for stateful coordination and real-time apps. Use for chat, multiplayer games, WebSocket hibernation, or encountering class export, migration, alarm errors.
cloudflare
Cloudflare Email Routing
Cloudflare Email Routing for receiving/sending emails via Workers. Use for email workers, forwarding, allowlists, or encountering Email Trigger errors, worker call failures, SPF issues.
cloudflareai
Cloudflare Hyperdrive
Cloudflare Hyperdrive for Workers-to-database connections with pooling and caching. Use for PostgreSQL/MySQL, Drizzle/Prisma, or encountering pool errors, TLS issues, connection refused.
postgresmysqlcloudflare
Cloudflare Images
This skill should be used when the user asks to \"upload images to Cloudflare\", \"implement direct creator upload\", \"configure image transformations\", \"optimize WebP/AVIF\", \"create image variants\", \"generate signed URLs\", \"add image watermarks\", \"integrate with Next…
cloudflareapi
Cloudflare Kv
Cloudflare Workers KV global key-value storage. Use for namespaces, caching, TTL, or encountering KV_ERROR, 429 rate limits, consistency issues.
cloudflarerag
Cloudflare Manager
Comprehensive Cloudflare account management for deploying Workers, KV Storage, R2, Pages, DNS, and Routes. Use when deploying cloudflare services, managing worker containers, configuring KV/R2 storage, or setting up DNS/routing. Requires CLOUDFLARE_API_KEY in .env and Bun runtim…
cloudflareapiairag
Cloudflare Mcp Server
Build MCP (Model Context Protocol) servers on Cloudflare Workers with tools, resources, and prompts.
cloudflare
Cloudflare Nextjs
Deploy Next.js to Cloudflare Workers via OpenNext adapter. Use for SSR, ISR, App/Pages Router, or encountering worker size limits, runtime compatibility, connection scoping errors.
nextjscloudflare
Cloudflare Queues
This skill should be used when the user asks to \"set up Cloudflare Queues\", \"create a message queue\", \"implement queue consumer\", \"process background jobs\", \"configure queue retry logic\", \"publish messages to queue\", \"implement dead letter queue\", or encountering \…
cloudflare
Cloudflare R2
Cloudflare R2 S3-compatible object storage. Use for buckets, uploads, CORS, presigned URLs, or encountering R2_ERROR, CORS failures, multipart issues.
cloudflareairag
Cloudflare Sandbox
Cloudflare Sandboxes SDK for secure code execution in Linux containers at edge. Use for untrusted code, Python/Node.js scripts, AI code interpreters, git operations.
pythonrustnodecloudflare+1
Cloudflare Turnstile
This skill should be used when the user asks to \"add turnstile\", \"implement bot protection\", \"validate turnstile token\", \"fix turnstile error\", \"setup captcha alternative\", or encounters error codes 100*/300*/600*, CSP errors, or token validation failures. Provides CAP…
reactcloudflareai
Cloudflare Vectorize
Cloudflare Vectorize vector database for semantic search and RAG. Use for vector indexes, embeddings, similarity search, or encountering dimension mismatches, filter errors.
cloudflareembeddingrag
Cloudflare Workers Ai
Cloudflare Workers AI for serverless GPU inference. Use for LLMs, text/image generation, embeddings, or encountering AI_ERROR, rate limits, token exceeded errors.
cloudflareaillmembedding
Cloudflare Workers Ci Cd
Complete CI/CD guide for Cloudflare Workers using GitHub Actions and GitLab CI. Use for automated testing, deployment pipelines, preview environments, secrets management, or encountering deployment failures, workflow errors, environment configuration issues.
cloudflaregithubgitlabtesting+2
Cloudflare Workers Dev Experience
Cloudflare Workers local development with Wrangler, Miniflare, hot reload, debugging. Use for project setup, wrangler.jsonc configuration, or encountering local dev, HMR, binding simulation errors.
cloudflare
Cloudflare Workers Frameworks
Framework integration for Cloudflare Workers. Use when building with Hono, Remix, Next.js, Astro, SvelteKit, Qwik, or Nuxt on Workers. Covers routing, SSR, static assets, and edge deployment.
cloudflaredeployment
Cloudflare Workers Migration
Migrate to Cloudflare Workers from AWS Lambda, Vercel, Express, and Node.js. Use when porting existing applications to the edge, adapting serverless functions, or resolving Node.js API compatibility issues.
nodeawsvercelcloudflare+1
Cloudflare Workers Multi Lang
Multi-language Workers development with Rust, Python, and WebAssembly. Use when building Workers in languages other than JavaScript/TypeScript, or when integrating WASM modules for performance-critical code.
pythontypescriptjavascriptrust+2
Cloudflare Workers Observability
Cloudflare Workers observability with logging, Analytics Engine, Tail Workers, metrics, and alerting. Use for monitoring, debugging, tracing, or encountering log parsing, metric aggregation, alert configuration errors.
cloudflaremonitoringai
Cloudflare Workers Performance
Cloudflare Workers performance optimization with CPU, memory, caching, bundle size. Use for slow workers, high latency, cold starts, or encountering CPU limits, memory issues, timeout errors.
cloudflareperformance
Cloudflare Workers Runtime Apis
Cloudflare Workers Runtime APIs including Fetch, Streams, Crypto, Cache, WebSockets, and Encoding. Use for HTTP requests, streaming, encryption, caching, real-time connections, or encountering API compatibility, response handling, stream processing errors.
cloudflareapi
Cloudflare Workers Security
Cloudflare Workers security with authentication, CORS, rate limiting, input validation. Use for securing APIs, JWT/API keys, or encountering auth failures, CORS errors, XSS/injection vulnerabilities.
cloudflaresecurityapiai
Cloudflare Workers Testing
Comprehensive testing guide for Cloudflare Workers using Vitest and @cloudflare/vitest-pool-workers. Use for test setup, binding mocks (D1/KV/R2/DO), integration tests, or encountering test failures, mock errors, coverage issues.
cloudflaretestingairag
Cloudflare Workflows
Cloudflare Workflows for durable long-running execution. Use for multi-step workflows, retries, state persistence, or encountering NonRetryableError, execution failed errors.
cloudflareai
Cloudflare Zero Trust Access
Cloudflare Zero Trust Access authentication for Workers. Use for JWT validation, service tokens, CORS, or encountering preflight blocking, cache race conditions, missing JWT headers.
rustcloudflare
Drizzle Orm D1
| Type-safe ORM for Cloudflare D1 databases using Drizzle. Use when: building D1 database schemas, writing type-safe SQL queries, managing migrations with Drizzle Kit, defining table relations, implementing prepared statements, using D1 batch API, or encountering D1_ERROR, trans…
cloudflareapiai
Hugo
Hugo static site generator with Tailwind v4, headless CMS (Sveltia/Tina), Cloudflare deployment. Use for blogs, docs sites, or encountering theme installation, frontmatter, baseURL errors.
gocloudflaredeploymentai
Neon Vercel Postgres
Neon + Vercel serverless Postgres for edge and serverless environments. Use for Cloudflare Workers, Vercel Edge, Next.js apps with HTTP/WebSocket connections, database branching (git-like), Drizzle/Prisma ORM integration, migrations, PITR backups, or encountering connection pool…
postgresvercelcloudflare
Nuxt Content
Nuxt Content v3 Git-based CMS for Markdown/MDC content sites. Use for blogs, docs, content-driven apps with type-safe queries, schema validation (Zod/Valibot), full-text search, navigation utilities. Supports Nuxt Studio production editing, Cloudflare D1/Pages deployment, Vercel…
vercelcloudflaredeploymentrag
Nuxt Studio
This skill should be used when the user asks to "set up Nuxt Studio", "configure Studio OAuth", "deploy Studio to Cloudflare", "add visual editor to Nuxt", "configure studio.domain.com subdomain", "Studio authentication", "Nuxt CMS", or mentions visual content editing, Nuxt Stud…
cloudflareai
Nuxt Production
| Nuxt 4 production optimization: hydration, performance, testing with Vitest, deployment to Cloudflare/Vercel/Netlify, and v4 migration. Use when: debugging hydration mismatches, optimizing performance and Core Web Vitals, writing tests with Vitest, deploying to Cloudflare Page…
vercelcloudflaretestingperformance+1
Tanstack Router
TanStack Router type-safe file-based routing for React. Use for SPAs, TanStack Query integration, Cloudflare Workers, or encountering devtools, type safety, loader, Vite bundling errors.
reactcloudflare
Tanstack Start
TanStack Start (RC) full-stack React with server functions, SSR, Cloudflare Workers. Use for Next.js migration, edge rendering, or encountering hydration, auth, data pattern errors.
reactcloudflare
Tanstack Table
TanStack Table v8 headless data tables with server-side features for Cloudflare Workers + D1. Use for pagination, filtering, sorting, virtualization, or encountering state management, TanStack Query coordination, URL sync errors.
cloudflare
Thesys Generative Ui
> Generate, modify, and style React components from natural language using the Thesys SDK. Guides schema-driven UI generation, theme customisation, tool calling integration, and deployment to Vite, Next.js, or Cloudflare Workers. Use when the user says "generate UI", "create a c…
reactcloudflaredeployment
Typescript Mcp
MCP servers with TypeScript on Cloudflare Workers using @modelcontextprotocol/sdk. Use for API integrations, stateless tools, edge deployments, or encountering export syntax, schema validation, memory leak, CORS, auth errors.
typescriptcloudflaredeploymentapi
Browse more topics
agentagent-skillsaiansibleanthropicapiarchitectureattestationauditautomationawsazurebenchmarkingbisectbrowserbuildcaptionschangelogchartsciclaudecleanupcloudflarecode-qualitycode-reviewcommitcompliancecomposecontainerscontentcontextcoveragecracsvd3datadatabasedebuggingdependenciesdeploymentdevelopmentdevopsdevtoolsdiagramsdiscorddjangodockerdocumentationdocumentsdocxdorae2eefficiencyembeddingengineering-code-qualityenvironmenteu-regulationevidenceexcelexplainerexplanationfaviconfilesflaskfrontendgcpgdprgitgithubgitlabgographqlhookshygieneimagesincident-responseindexesinfrastructureiosjavascriptjirakotlinkuberneteslearninglinearlintingllmmaintenancemcpmemorymermaidmetameta-tagsmigrationmigrationsmobilemonitoringmonorepomysqlnextjsnis2nodenpmofficialonboardingopenapioptimizationowasppackagesparsingpatternspdfperformanceplanningplaywrightpostgrespowerpointpptxprprivacyproductivityprofilingprotocolprototypingpwapythonqaquery-optimizationragrapid-developmentreactredisrefactoringregexregressionreleasereportsrestreviewrustsafetyschemascrapingsdksdlcsecuritysemverserversetupskillsslackslidesspreadsheetssqlsqliteswaggerswifttddteachingtest-generationtestingthreat-modelingtokenstranscripttypescriptutilityvalidationvercelversioningvibe-codingvideovisualizationvuevulnerabilitiesvulnerability-managementwebwordworkflowworkflowsworkspacexcodexlsxyoutube